Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas campestris pv. campestris Type II secretion system protein F (xpsF)

This Recombinant Xanthomonas campestris pv. campestris Type II secretion system protein F (xpsF) spans the amino acid sequence from region 1-405.

Product Specifications

Product Name Alternative

Type II secretion system protein F, T2SS protein F, General secretion pathway protein F

UniProt

P31744

Expression Region

1-405

Origin

Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLYRYKALDAHGEMLDGQMEAANDAEVALRLQEQGHLPVETRLATGENGSPSLRMLLRK KPFDNAALVQFTQQLATLIGAGQPLDRALSILMDLPEDDKSRRVIADIRDTVRGGAPLSV ALERQHGLFSKLYINMVRAGEAGGSMQDTLQRLADYLERSRALKGKVINALIYPAILLAV VGCALLFLLGYVVPQFAQMYESLDVALPWFTQAVLSVGLLVRDWWLVLVVIPGVLGLWLD RKRRNAAFRAALDAWLLRQKVIGSLIARLETARLTRTLGTLLRNGVPLLAAIGIARNVMS NTALVEDVAAAADDVKNGHGLSMSLARGKRFPRLALQMIQVGEESGALDTMLLKTADTFE LETAQAIDRALAALVPLITLVLASVVGLVIISVLVPLYDLTNAIG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL
BNC040977-100 1x 100 µL

TGF-beta (1D11.16.8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL
BNC940270-500 1x 500 µL

Fibronectin (HFN7.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF405S conjugate, 0.1mg/mL
BNC040373-500 1x 500 µL

Human IgM Immunoglobulin (IM373), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), Biotin conjugate, 0.1mg/mL
BNCB0861-500 1x 500 µL

HSP27 (G3.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details