Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lodderomyces elongisporus Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Lodderomyces elongisporus Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1

UniProt

A5DV96

Expression Region

1-406

Origin

Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGYIPPPGDNDDNGKKSNKKTQNTSKPISSDSTPDGTTITIINPMSLIPRNPSFGLIWGP LTPASDNRPAMYTMVALQIAIGVRFFRYARTHLRRHPVPQAQFHAPPGLGVNSMISTTAN QTYSAPPQQFLRRSKGDVFKSILAITTGSLLIFGSGLEIARMMLPYDPWYDEAQFYRKQA VRNGDKPNFWFGAYQYYQPMTYKEWHSKVSKWIDSVEKEIKVDETTFVIDKDGKARGGIG PAGVGYVNGAGQQSGAASAAAAVAKPLFQIRNRAKYQQIHAKLYNANETRMRELLANELN DTNVNELNKAERLDKILEGKSDLVNPNFNKPSISLGNHPMESDDEFEMVWLNFEPWDELK METDYDIRLIPRYASVEELEQVDEGELFVVKKEELGETDNVVNESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-500 1x 500 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF740 conjugate, 0.1mg/mL
BNC740634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF740 conjugate, 0.1mg/mL
BNC742035-100 1x 100 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF568 conjugate, 0.1mg/mL
BNC681687-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), CF640R conjugate, 0.1mg/mL
BNC400424-500 1x 500 µL

CD147 (8D6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Secretory Component / ECM1 (ECM1/2889R), CF405S conjugate, 0.1mg/mL
BNC042889-100 1x 100 µL

Secretory Component / ECM1 (ECM1/2889R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details