Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lodderomyces elongisporus Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Lodderomyces elongisporus Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1

UniProt

A5DV96

Expression Region

1-406

Origin

Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGYIPPPGDNDDNGKKSNKKTQNTSKPISSDSTPDGTTITIINPMSLIPRNPSFGLIWGP LTPASDNRPAMYTMVALQIAIGVRFFRYARTHLRRHPVPQAQFHAPPGLGVNSMISTTAN QTYSAPPQQFLRRSKGDVFKSILAITTGSLLIFGSGLEIARMMLPYDPWYDEAQFYRKQA VRNGDKPNFWFGAYQYYQPMTYKEWHSKVSKWIDSVEKEIKVDETTFVIDKDGKARGGIG PAGVGYVNGAGQQSGAASAAAAVAKPLFQIRNRAKYQQIHAKLYNANETRMRELLANELN DTNVNELNKAERLDKILEGKSDLVNPNFNKPSISLGNHPMESDDEFEMVWLNFEPWDELK METDYDIRLIPRYASVEELEQVDEGELFVVKKEELGETDNVVNESS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (HRP)
MBS6180019-01 0.1 mL

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (HRP)

Sign In for Pricing
View Details
NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (HRP)
MBS6180019-02 5x 0.1 mL

NHLH2 (Nescient Helix Loop Helix 2, HEN2, KIAA0490, NSCL2, bHLHa34) (HRP)

Sign In for Pricing
View Details
Recombinant Human DTD1 Protein, His, E.coli-10ug
QP11708-10ug 10ug

Recombinant Human DTD1 Protein, His, E.coli-10ug

Sign In for Pricing
View Details
Bovine Galectin 2 GAL2 ELISA Kit
BG-BVN11064 1 Each

Bovine Galectin 2 GAL2 ELISA Kit

Sign In for Pricing
View Details
STAT5b Protein (N-His, Human)
P528779 100 µg

STAT5b Protein (N-His, Human)

Sign In for Pricing
View Details
Canine TNF Superfamily Member 13b (TNFSF13B) ELISA Kit-Sandwich
EK10F862-01 48 Test

Canine TNF Superfamily Member 13b (TNFSF13B) ELISA Kit-Sandwich

Sign In for Pricing
View Details