Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. UPF0754 membrane protein CYB_2931 (CYB_2931)

This Recombinant Synechococcus sp. UPF0754 membrane protein CYB_2931 (CYB_2931) spans the amino acid sequence from region 1-406.

Product Specifications

Product Name Alternative

UPF0754 membrane protein CYB_2931

UniProt

Q2JHS8

Expression Region

1-406

Origin

Synechococcus sp. (strain JA-2-3B'a (2-13) ) (Cyanobacteria bacterium Yellowstone B-Prime)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFWIYVVPPLAGLVIGYFTNDIAIKMLFRPYRPYRVFGWRIPFTPGLIPQNQPRLAKQI AKTIMGSLLTPEELHNLARKLLQTERMQAGIRWLLGVALDRLQNPEQQQQTAQVLARILA DLFNESLPRLVKVLARQETFLEGPINQLFDQVLLELRLSSEQAKQLSEWILKQALPPKVL RQNLVDFLTDRNIESLDEEFRERATGSYWVVANLFGLKNALLRLRTYCLEEPEGAEAILE DLLKDINASRRLTEILQNLSLQNLPVSAVRQLRRALRDGIQDYLRSQGPEVIKGLGETID WEKVASLVLGRLRNSKALITSIDQISADLALVLERYLERDLESLMMQVIPVLNLDQVIAD KVNATSPADLEQAIQQIVRQELQAIVNLGGLLGFLVGCVQVLFLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-100 1x 100 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-500 1x 500 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details