Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage I2-2 Virion export protein (IV)

This Recombinant Enterobacteria phage I2-2 Virion export protein (IV) spans the amino acid sequence from region 23-428.

Product Specifications

Product Name Alternative

Virion export protein, Gene 4 protein, G4P

UniProt

P15420

Expression Region

23-428

Origin

Enterobacteria phage I2-2 (Bacteriophage I2-2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EPVTLNNSPVRSFVQWYSSKTGKSVIVNPDVKGNITVFNADVNNANIDDFFKSVLNANGL VVVAGNPAVVSTPLTKLASQPSNEETYDDESDGVAYEAVPQSAAPAVPADLTVRNFNVTR VRSSDVLPLAKIFVDSNGGGNVVDYPGNNSLVVSGSAQVMPALSDFITSIDVAREQVLIQ SLMFETSVSNGVDLSFALALASGGKVAGGFNTSALGTALSTAGGSFGIFNGNILALSLQA VQSDSNSKVISTPRILTQSGQSGYISVGQNVPFVTGKVTGEAASVNNPFQTIERRDVGVS LKVTPVVMGNGQLVLTIDTKADSLSNQAIASDIITNQRQIQTTVQIKDGQTLLLGGLISS NQFDSDRSVPFMSKIPLIGWLFRSHSDSKDDRTMFVLLTAHVIRAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protocadherin-10 Recombinant Protein
91-543 0.05 mg

Protocadherin-10 Recombinant Protein

Sign In for Pricing
View Details
IDE CRISPR/Cas9 KO Plasmid (m)
sc-421021 20 µg

IDE CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Human Cadherin related family member 2 (PCDH24) ELISA Kit
MBS7241168-01 48 Well

Human Cadherin related family member 2 (PCDH24) ELISA Kit

Sign In for Pricing
View Details
Human Cadherin related family member 2 (PCDH24) ELISA Kit
MBS7241168-02 96 Well

Human Cadherin related family member 2 (PCDH24) ELISA Kit

Sign In for Pricing
View Details
Human Cadherin related family member 2 (PCDH24) ELISA Kit
MBS7241168-03 5x 96 Well

Human Cadherin related family member 2 (PCDH24) ELISA Kit

Sign In for Pricing
View Details
Human Cadherin related family member 2 (PCDH24) ELISA Kit
MBS7241168-04 10x 96 Well

Human Cadherin related family member 2 (PCDH24) ELISA Kit

Sign In for Pricing
View Details