Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage I2-2 Virion export protein (IV)

This Recombinant Enterobacteria phage I2-2 Virion export protein (IV) spans the amino acid sequence from region 23-428.

Product Specifications

Product Name Alternative

Virion export protein, Gene 4 protein, G4P

UniProt

P15420

Expression Region

23-428

Origin

Enterobacteria phage I2-2 (Bacteriophage I2-2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EPVTLNNSPVRSFVQWYSSKTGKSVIVNPDVKGNITVFNADVNNANIDDFFKSVLNANGL VVVAGNPAVVSTPLTKLASQPSNEETYDDESDGVAYEAVPQSAAPAVPADLTVRNFNVTR VRSSDVLPLAKIFVDSNGGGNVVDYPGNNSLVVSGSAQVMPALSDFITSIDVAREQVLIQ SLMFETSVSNGVDLSFALALASGGKVAGGFNTSALGTALSTAGGSFGIFNGNILALSLQA VQSDSNSKVISTPRILTQSGQSGYISVGQNVPFVTGKVTGEAASVNNPFQTIERRDVGVS LKVTPVVMGNGQLVLTIDTKADSLSNQAIASDIITNQRQIQTTVQIKDGQTLLLGGLISS NQFDSDRSVPFMSKIPLIGWLFRSHSDSKDDRTMFVLLTAHVIRAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF227 antibody
70R-8165 50 ug

ZNF227 antibody

Sign In for Pricing
View Details
Fadolmidine Hydrochloride
TRC-F101040-10MG 10 mg

Fadolmidine Hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Slc45a3 shRNA (UAS) - Lentiviral mouse Slc45a3 shRNA (UAS, iRFP) (100)
GTR15263067 1 Vial

Lentiviral mouse Slc45a3 shRNA (UAS) - Lentiviral mouse Slc45a3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RXRA (FLJ16733, Retinoid X Receptor alpha, FLJ00280, FLJ00318) (MaxLight 650)
MBS6436514-01 0.1 mL

RXRA (FLJ16733, Retinoid X Receptor alpha, FLJ00280, FLJ00318) (MaxLight 650)

Sign In for Pricing
View Details
RXRA (FLJ16733, Retinoid X Receptor alpha, FLJ00280, FLJ00318) (MaxLight 650)
MBS6436514-02 5x 0.1 mL

RXRA (FLJ16733, Retinoid X Receptor alpha, FLJ00280, FLJ00318) (MaxLight 650)

Sign In for Pricing
View Details
Mrpl38 (BC002319) Mouse Tagged ORF Clone Lentiviral Particle
MR205223L4V 200 µL

Mrpl38 (BC002319) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details