Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protein CNPPD1 (Cnppd1)

This Recombinant Mouse Protein CNPPD1 (Cnppd1) spans the amino acid sequence from region 1-407.

Product Specifications

Product Name Alternative

Protein CNPPD1

UniProt

Q8K158

Expression Region

1-407

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLTGLLLDEEGAFSLTGFQDFMVLPGHQKLSARIRRRLYYGWDLETDCSLEELSSPVAD ITVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVATLNALERSFLSAMDWRLYTDPRE IFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV SSVALAVASVAVIHQSLGLSSSPSPGPPELTLVSKSLVQPCVPAPVSQCLTNVSSCLEGS VDLPSLWGSLLAPLTPPLRPPPDPPAPPTPLHKCPLCQKFQRLPPNCRACHTNQTVSIGP SRPLYHARGLAPPWLWSPVAPPFLQPQQCSLFSVMELAHLKSVISPG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (3,4-Dichlorophenyl) -2-phenylacetic acid
sc-287508A 250 mg

2- (3,4-Dichlorophenyl) -2-phenylacetic acid

Sign In for Pricing
View Details
Junctional Adhesion Molecule 1 (JAM-1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301)
128700 100 µg

Junctional Adhesion Molecule 1 (JAM-1, CD321, F11 Receptor, F11R, Junctional Adhesion Molecule A, JAMA, JCAM, KAT, Platelet Adhesion Molecule 1, PAM1, Platelet F11 Receptor, UNQ264/PRO301)

Sign In for Pricing
View Details
Ubiquitin C-Terminal Hydrolase L1 (UCH-L1) (MaxLight 490)
MBS6504689-01 0.1 mL

Ubiquitin C-Terminal Hydrolase L1 (UCH-L1) (MaxLight 490)

Sign In for Pricing
View Details
Ubiquitin C-Terminal Hydrolase L1 (UCH-L1) (MaxLight 490)
MBS6504689-02 5x 0.1 mL

Ubiquitin C-Terminal Hydrolase L1 (UCH-L1) (MaxLight 490)

Sign In for Pricing
View Details
GENLISA™ Mouse Tumor Necrosis Factor Receptor Superfamily, Member 17 (TNFRSF17) ELISA
KLM2539 1x 96 Well

GENLISA™ Mouse Tumor Necrosis Factor Receptor Superfamily, Member 17 (TNFRSF17) ELISA

Sign In for Pricing
View Details
Lentiviral mouse Il17b shRNA (UAS) - Lentiviral mouse Il17b shRNA (UAS) plasmid
GTR15304294 1 Vial

Lentiviral mouse Il17b shRNA (UAS) - Lentiviral mouse Il17b shRNA (UAS) plasmid

Sign In for Pricing
View Details