Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized PPE family protein PPE45 (ppe45)

This Recombinant Uncharacterized PPE family protein PPE45 (ppe45) spans the amino acid sequence from region 1-408.

Product Specifications

Product Name Alternative

Uncharacterized PPE family protein PPE45

UniProt

P0A694

Expression Region

1-408

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFGVLPPEINSGRMYAGPGSGPMMAAAAAWDSLAAELGLAAGGYRLAISELTGAYWAGP AAASMVAAVTPYVAWLSATAGQAEQAGMQARAAAAAYELAFAMTVPPPVVVANRALLVAL VATNFFGQNTPAIAATEAQYAEMWAQDAAAMYAYAGSAAIATELTPFTAAPVTTSPAALA GQAAATVSSTVPPLATTAAVPQLLQQLSSTSLIPWYSALQQWLAENLLGLTPDNRMTIVR LLGISYFDEGLLQFEASLAQQAIPGTPGGAGDSGSSVLDSWGPTIFAGPRASPSVAGGGA VGGVQTPQPYWYWALDRESIGGSVSAALGKGSSAGSLSVPPDWAARARWANPAAWRLPGD DVTALRGTAENALLRGFPMASAGQSTGGGFVHKYGFRLAVMQRPPFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coconut Oil Monoethanolamide
TRC-A182055-50MG 50 mg

Coconut Oil Monoethanolamide

Sign In for Pricing
View Details
Recombinant Mouse PLA1 protein (His tag)
PDEM100254-01 20 µg

Recombinant Mouse PLA1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse PLA1 protein (His tag)
PDEM100254-02 100 µg

Recombinant Mouse PLA1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse PLA1 protein (His tag)
PDEM100254-03 500 µg

Recombinant Mouse PLA1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse PLA1 protein (His tag)
PDEM100254-04 1 mg

Recombinant Mouse PLA1 protein (His tag)

Sign In for Pricing
View Details
FLVCR (FLVCR1) (NM_014053) Human Over-expression Lysate
LC402273 20 µg

FLVCR (FLVCR1) (NM_014053) Human Over-expression Lysate

Sign In for Pricing
View Details