Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Menaquinol-cytochrome c reductase iron-sulfur subunit (qcrA)

This Recombinant Corynebacterium glutamicum Menaquinol-cytochrome c reductase iron-sulfur subunit (qcrA) spans the amino acid sequence from region 1-408.

Product Specifications

Product Name Alternative

Menaquinol-cytochrome c reductase iron-sulfur subunit, Cytochrome bc1 complex Rieske iron-sulfur protein, Rieske iron-sulfur protein

UniProt

Q79VE8

Expression Region

1-408

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNNNDKQYTTQELNAMSNEDLARLGTELDDVTIAYRKERFPIANDPAEKRAARAVTFWL VLGIIGGLGFLATYIFWPWEYKAHGDEGLLAYTLYTPMLGITSGLCILSLGFAVVLYVKK FIPEEIAVQRRHDGPSEEVDRRTIVALLNDSWQTSTLGRRKLIMGLAGGGAVLAGLTIIA PMGGMIKNPWNPKEGPMDVQGDGTLWTSGWTLVENDVKVYLGRDTAAIAESHTDATGEHW STTGVSRLVRMRPEDLAAASMETVFPLPAEMVNDGAEYDPAKDVYEHQMHSVHGPRNAVM LIRLRTADAEKVIEREGQESFHYGDYYAYSKICTHIGCPTSLYEAQTNRILCPCHQSQFD ALHYGKPVFGPAARALPQLPITVDEEGYLIAAGNFIEPLGPAFWERKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF6 Polyclonal Antibody
A72405-050 50 µL

EIF6 Polyclonal Antibody

Sign In for Pricing
View Details
FKBP1B Protein Vector (Rat) (pPM-C-HA)
PV268632 500 ng

FKBP1B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CDRT15 Protein Vector (Human) (pPB-N-His)
PV068622 500 ng

CDRT15 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ZZZ3 Human Over-expression Lysate
orb1348524 100 µg

ZZZ3 Human Over-expression Lysate

Sign In for Pricing
View Details
PDSS2 sgRNA CRISPR Lentivector (Human) (Target 1)
K1623802 1.0 µg DNA

PDSS2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ASMT (NM_001171038) Human Over-expression Lysate
LC432958 20 µg

ASMT (NM_001171038) Human Over-expression Lysate

Sign In for Pricing
View Details