Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Fas apoptotic inhibitory molecule 3 (Faim3)

This Recombinant Rat Fas apoptotic inhibitory molecule 3 (Faim3) spans the amino acid sequence from region 18-426.

Product Specifications

Product Name Alternative

Fas apoptotic inhibitory molecule 3, Regulator of Fas-induced apoptosis Toso

UniProt

Q5M871

Expression Region

18-426

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KVLPEVRLEVELGGSVFIECPLPQTHVRMYLCRQMTNPAICATVVSNIFVKKEYKRRVTL KPSLNKKLFLVEMTQLTKDDEGIYACGVGTNTDLGKTQKVTLNVRNEFPEYPEPFWDDEP TSEPSPRWWLHRYPEELPWLKMGEHASPSGFIDKVTTLSPKTEAPPVHQPSTNTSVSRHP RVYGASSETPTKPSALLPATTAFKTSARQASRLLEASYSHHTRLHGERTPHYGSQYGRED RGLHISIPEFHILIPTFLGFLLLVLLGLVVKRAIQRRRAFSRRVGRMARRMRGRGPSRQI PTQRRDAPQRPRSQNNVYSACPRRAREPDNVGSAEALLLNAPASAPPALPLVIETSWPHT PSLKMSCEYVSLGHQPAVNVEDQDSNDYINIPGLPHLPSKPPGPRPSRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL
BNC940437-100 1x 100 µL

CD47 (B6H12.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details