Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae LETM1 domain-containing protein YLH47, mitochondrial (YLH47)

This Recombinant Saccharomyces cerevisiae LETM1 domain-containing protein YLH47, mitochondrial (YLH47) spans the amino acid sequence from region 46-454.

Product Specifications

Product Name Alternative

LETM1 domain-containing protein YLH47, mitochondrial, LETM1 homolog

UniProt

Q06493

Expression Region

46-454

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NSSVPESSKKELKTTDGNQESASKVSPVKEKEKVPFKVKMQKALRHYWDGSKLLGLEIKI SSKLLMKSAAGYPLTRRENLQLKRTTQDIVRLVPFAAFLIIPFAELLLPFALKLFPNLLP STYESSKKRENKLENLRNTRKLMSEIIKNNKSHFKPNNISEEQKALFNRFYTHVRATGVP ESRQQLIEVARLFTDDTVLDNVTRPYLIALAKYMNLQPFGTDVMLRYRIRYKMLELKKDD LSIYYEDAEQLSLSELKTACASRGIRSVDVEPSVLYSNLRLWLNMRLKDKIPSTLLIMAT AYNYGNVQSKESLYDALCDVLIGIPDELYHEVKVNVVKEDEASAKQKLKQLREQEEIMKE EEQQEENAIVSVKDELSLDDQDKNIDAAAPDVKPHDTKPIGEAAAIKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL
BNC470745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details