Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF430

This Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF430 spans the amino acid sequence from region 21-430.

Product Specifications

Product Name Alternative

Putative assembly protein ORF430, ORF430

UniProt

P03668

Expression Region

21-430

Origin

Pseudomonas phage Pf3 (Bacteriophage Pf3)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SDRLTVKHHEIDIRVAIPLVADFCGRSVVLGPSIQGVVSLDFDDVPCSQAFDLLLESNHL LSSMVGDVLVITAMDQVLNSERKADDLRTFRRDLFNANDIERRVINIVHASASEVVSLFK ESFMSLDAPGMSMTVDERTNSVFAALPSSFFPALESVIQAIDVPVRQVAIEANVVEASVD WSKRLGLNWGGALSLGNWSAVTAGDLSVAAGSSIGFGFLSNTLSLDGLFTAMENEGNGRV VSRPTLLTLDRQSASVLRGTELPYQQSAGDGATSVAFKHAALSLEVKPVISPDNSIVIEV LVSRDSPNFSNAIDGVPPIDTNRLVTTIRVPHGQTVVLGGVYSTINQQGSSRVSGISRIP GIGRLFKKKEHVTEQYELLIFLTPRILGLEVEPEKQSLVFDESFFLGDLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18/835), 0.2mg/mL
BNUB0835-100 1x 100 µL

Cytokeratin 18 (KRT18/835), 0.2mg/mL

Sign In for Pricing
View Details
FBXO38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
20331062 1.0 µg DNA

FBXO38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human DPEP1 Knockout HEK293T cell line
GTR15414173 1 Vial

Human DPEP1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Recombinant Human VRK1 (N-GST tag)
MBS4160404-01 0.01 mg

Recombinant Human VRK1 (N-GST tag)

Sign In for Pricing
View Details
Recombinant Human VRK1 (N-GST tag)
MBS4160404-02 5x 0.01 mg

Recombinant Human VRK1 (N-GST tag)

Sign In for Pricing
View Details
Cdc37 (phospho Ser13) Polyclonal Antibody
UB-GEN-16037 100 µL

Cdc37 (phospho Ser13) Polyclonal Antibody

Sign In for Pricing
View Details