Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Acyl-CoA-binding domain-containing protein 5-B (acbd5b)

This Recombinant Danio rerio Acyl-CoA-binding domain-containing protein 5-B (acbd5b) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Acyl-CoA-binding domain-containing protein 5-B

UniProt

A5WV69

Expression Region

1-410

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILRGMEDSKSAQKRFEAAVKVIRSLPEDGSYDLSDDMLVLFYSYYKQATEGPCNTLKPN SWDPIGKAKWEAWKDLGNMSKDQAMTEYVQEIQLIIETLPVTDRMAELLDALDPFYEIVE DDDDDDDEGVSKAAPLFTGSTNADKDAERDEEVESESKEGNLDDYMELVEKQKDLSSTTG EKGSLLVFNRSEENSISSLTDGTHSSLNTVDDEEELVYDGSDDEMDSDSMDKPATPEKGS GVRSVRLADGSVVGANMQHGGNREPQCGSQDGKPQGLISPVPHPPTLGTVRNDRISACSG RERGCQGDGGQRGETADRMDKQAINTQITTILSELEDNMQDVLRRLTTLEQLTASQAEIS PSKTWHSDKPKKRLSWWPLNSSPFTAVLTVLWPFAVHWLVQFYLQRRRRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), 0.2mg/mL
BNUB2250-100 1x 100 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant NRF1 Antibody
RC-5194-01 50 μL

Recombinant NRF1 Antibody

Sign In for Pricing
View Details
Recombinant NRF1 Antibody
RC-5194-02 100 µL

Recombinant NRF1 Antibody

Sign In for Pricing
View Details
Recombinant NRF1 Antibody
RC-5194-03 1 mL

Recombinant NRF1 Antibody

Sign In for Pricing
View Details
Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: 3H2]
AM26107PU-N 100 µg

Laminin alpha 4 (LAMA4) Mouse Monoclonal Antibody [Clone ID: 3H2]

Sign In for Pricing
View Details
Recombinant COX6C Antibody
RC-4849-01 50 μL

Recombinant COX6C Antibody

Sign In for Pricing
View Details