Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Coiled-coil domain-containing protein 51 (Ccdc51)

This Recombinant Rat Coiled-coil domain-containing protein 51 (Ccdc51) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 51

UniProt

Q5PPN7

Expression Region

1-410

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGCSPVFTMQQVVGVSHRLVWRTFRGTDLLMTRTLCSPGPSRPGEKRPEAAALGLYHRL PELGRTLSHTIRNQAASTAKAWWDRYEEFVGLNEVREAQGNVTEAEKVFMVARGLVREAR EDLEAQQTKLKEVRDRLDRVSREDNQYLELATLEHRMLQEEKRLRIAYLRAEDSEREKFS LFSAAVRESHEKERTRAERTKNWSLIGSVLGALIGVAGSTYVNRVRLQELKALLLEAQKG PVSLQEAIREQASSYSLQQKDLQNLMVDLRGLVHVGQDQGSGSPTGPSSPRGKDIDGLSA AMKEQLNHSRQVYSCLEGLREQLDSLEKTCSQMAGVVRLAKVPAHPGMVEPLDGALPSSL LEHGSTMLALSEMEQRLEAQANRNAISSTLVTCVTFMATLPLLYMLFKTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGSF5, NT (IGSF5, JAM4, Immunoglobulin superfamily member 5, Junctional adhesion molecule 4) (FITC) discontinued
036927-FITC 200 µL

IGSF5, NT (IGSF5, JAM4, Immunoglobulin superfamily member 5, Junctional adhesion molecule 4) (FITC) discontinued

Sign In for Pricing
View Details
RARS Antibody
A32832-50UG 50 µg

RARS Antibody

Sign In for Pricing
View Details
VE-Statin/EGFL7 Overexpression Lysate (Native) - (Dry Ice)
NBP2-04585 0.1 mg

VE-Statin/EGFL7 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
PPP3CC Antibody - C-terminal region : FITC (ARP64741_P050-FITC)
ARP64741_P050-FITC 100 µL

PPP3CC Antibody - C-terminal region : FITC (ARP64741_P050-FITC)

Sign In for Pricing
View Details
CheKine Mirco Glycogen Phosphorylase a (GPa) Activity Assay Kit
orb3148306-01 48 Tests

CheKine Mirco Glycogen Phosphorylase a (GPa) Activity Assay Kit

Sign In for Pricing
View Details
CheKine Mirco Glycogen Phosphorylase a (GPa) Activity Assay Kit
orb3148306-02 96 Tests

CheKine Mirco Glycogen Phosphorylase a (GPa) Activity Assay Kit

Sign In for Pricing
View Details