Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Protein CNPPD1 (CNPPD1)

This Recombinant Pongo abelii Protein CNPPD1 (CNPPD1) spans the amino acid sequence from region 1-410.

Product Specifications

Product Name Alternative

Protein CNPPD1

UniProt

Q5R4U5

Expression Region

1-410

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVAD IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPRE IFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV SSVALAVASVAVIHQSLGLSCTPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLE GSTGLRSLWGSLLASLTPPPLPPPDPPAPPTPFHNCHLCQKLQRDSPTCHACHHPNRTAP TALSSPWYHTYGLAPPWPWSPVPASIPQPQQCSLFSIMELARLKSFIFPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Omadacycline Impurity 12
RM-O542012-01 10 mg

Omadacycline Impurity 12

Sign In for Pricing
View Details
Omadacycline Impurity 12
RM-O542012-02 25 mg

Omadacycline Impurity 12

Sign In for Pricing
View Details
Omadacycline Impurity 12
RM-O542012-03 50 mg

Omadacycline Impurity 12

Sign In for Pricing
View Details
Omadacycline Impurity 12
RM-O542012-04 100 mg

Omadacycline Impurity 12

Sign In for Pricing
View Details
KRT12 (Keratin, Type I Cytoskeletal 12, Cytokeratin-12, Keratin-12) (MaxLight 490)
MBS6383823-01 0.1 mL

KRT12 (Keratin, Type I Cytoskeletal 12, Cytokeratin-12, Keratin-12) (MaxLight 490)

Sign In for Pricing
View Details
KRT12 (Keratin, Type I Cytoskeletal 12, Cytokeratin-12, Keratin-12) (MaxLight 490)
MBS6383823-02 5x 0.1 mL

KRT12 (Keratin, Type I Cytoskeletal 12, Cytokeratin-12, Keratin-12) (MaxLight 490)

Sign In for Pricing
View Details