Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acetylcholine receptor-like protein cup-4 (cup-4)

This Recombinant Acetylcholine receptor-like protein cup-4 (cup-4) spans the amino acid sequence from region 25-435.

Product Specifications

Product Name Alternative

Acetylcholine receptor-like protein cup-4, Coelomocyte uptake defective protein 4

UniProt

A8XF54

Expression Region

25-435

Origin

Caenorhabditis briggsae

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQQGIDSEEGDAETFFNRTYSAHQSDLEKRIFRGYDIKKRPVKNASVPTVVDVHWHVIHV SINQKEQTMTLHGHIYMRWYDEYLVWDPKDFAGIHYARVKKWQVWQPKIRVSNSASGLAS AFDFSTSAHVIIQMVEKDRAKVEMYPTFSIKVGCMFDFGDFPYDQNKCSVNLFATDTMAE VQLQNLYNIPPTLSFGWEEQKMKRIISDFKILNVSASQFYYGSGNVSKTAPVTGFELGNT WSMLAVNVDFVRHSPYFWSTIVAPTLVCTMFIQVSFFAPTVSLAFVINLMAIYLEFMFLQ DITIKIPLYLSKRPSSITLFHILLISNIVSAVFHGVLCALCSTKVPVPLPIRKIYAVKDY VPASWKEEGMVVDYACDTNWTEWTRTARPLAGLAMFVYFVIMFILYLVVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311 + OCA1/812), CF405S conjugate, 0.1mg/mL
BNC040908-500 1x 500 µL

Tyrosinase (T311 + OCA1/812), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PDZ and LIM Domain 1 (CPTC-PDLIM1-1), CF568 conjugate, 0.1mg/mL
BNC682272-100 1x 100 µL

PDZ and LIM Domain 1 (CPTC-PDLIM1-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD23 (Fc Epsilon RII) (FCER2/3592), CF488A conjugate, 0.1mg/mL
BNC883592-100 1x 100 µL

CD23 (Fc Epsilon RII) (FCER2/3592), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pure Agaricus bisporus Lectin (Mushroom) -ABA-
L-5001-2 2 mg

Pure Agaricus bisporus Lectin (Mushroom) -ABA-

Sign In for Pricing
View Details
Mouse Chymotrypsin-Like Elastase Family Member 2A (ELA2A) ELISA Kit
RDR-ELA2A-Mu-01 96 Tests

Mouse Chymotrypsin-Like Elastase Family Member 2A (ELA2A) ELISA Kit

Sign In for Pricing
View Details
Mouse Chymotrypsin-Like Elastase Family Member 2A (ELA2A) ELISA Kit
RDR-ELA2A-Mu-02 48 Tests

Mouse Chymotrypsin-Like Elastase Family Member 2A (ELA2A) ELISA Kit

Sign In for Pricing
View Details