Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acetylcholine receptor-like protein cup-4 (cup-4)

This Recombinant Acetylcholine receptor-like protein cup-4 (cup-4) spans the amino acid sequence from region 25-435.

Product Specifications

Product Name Alternative

Acetylcholine receptor-like protein cup-4, Coelomocyte uptake defective protein 4

UniProt

A8XF54

Expression Region

25-435

Origin

Caenorhabditis briggsae

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQQGIDSEEGDAETFFNRTYSAHQSDLEKRIFRGYDIKKRPVKNASVPTVVDVHWHVIHV SINQKEQTMTLHGHIYMRWYDEYLVWDPKDFAGIHYARVKKWQVWQPKIRVSNSASGLAS AFDFSTSAHVIIQMVEKDRAKVEMYPTFSIKVGCMFDFGDFPYDQNKCSVNLFATDTMAE VQLQNLYNIPPTLSFGWEEQKMKRIISDFKILNVSASQFYYGSGNVSKTAPVTGFELGNT WSMLAVNVDFVRHSPYFWSTIVAPTLVCTMFIQVSFFAPTVSLAFVINLMAIYLEFMFLQ DITIKIPLYLSKRPSSITLFHILLISNIVSAVFHGVLCALCSTKVPVPLPIRKIYAVKDY VPASWKEEGMVVDYACDTNWTEWTRTARPLAGLAMFVYFVIMFILYLVVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1S,2R,3S) Metconazole Carboxylic Acid
TRC-M485620-25MG 25 mg

(1S,2R,3S) Metconazole Carboxylic Acid

Sign In for Pricing
View Details
OR13F1 Antibody
8G510-AAT 50 µg

OR13F1 Antibody

Sign In for Pricing
View Details
2-Ketoglutaric Acid-13C1
TRC-K191202-5MG 5 mg

2-Ketoglutaric Acid-13C1

Sign In for Pricing
View Details
Anti-Apg7 Antibody [SC06-30]
ET1610-53TR 20 µL

Anti-Apg7 Antibody [SC06-30]

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF405S conjugate, 0.1mg/mL
BNC041909-500 1x 500 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/1909), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Erio Green B (Technical Grade)
TRC-E600093-500MG 500 mg

Erio Green B (Technical Grade)

Sign In for Pricing
View Details