Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acetylcholine receptor-like protein cup-4 (cup-4)

This Recombinant Acetylcholine receptor-like protein cup-4 (cup-4) spans the amino acid sequence from region 25-435.

Product Specifications

Product Name Alternative

Acetylcholine receptor-like protein cup-4, Coelomocyte uptake defective protein 4

UniProt

A8XF54

Expression Region

25-435

Origin

Caenorhabditis briggsae

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QQQGIDSEEGDAETFFNRTYSAHQSDLEKRIFRGYDIKKRPVKNASVPTVVDVHWHVIHV SINQKEQTMTLHGHIYMRWYDEYLVWDPKDFAGIHYARVKKWQVWQPKIRVSNSASGLAS AFDFSTSAHVIIQMVEKDRAKVEMYPTFSIKVGCMFDFGDFPYDQNKCSVNLFATDTMAE VQLQNLYNIPPTLSFGWEEQKMKRIISDFKILNVSASQFYYGSGNVSKTAPVTGFELGNT WSMLAVNVDFVRHSPYFWSTIVAPTLVCTMFIQVSFFAPTVSLAFVINLMAIYLEFMFLQ DITIKIPLYLSKRPSSITLFHILLISNIVSAVFHGVLCALCSTKVPVPLPIRKIYAVKDY VPASWKEEGMVVDYACDTNWTEWTRTARPLAGLAMFVYFVIMFILYLVVRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic Red® Fluorescent Caspase-3/7 Assay Kit
935 25 Tests

Magic Red® Fluorescent Caspase-3/7 Assay Kit

Sign In for Pricing
View Details
Single Frequency type Ultrasonic Cleaner BULC-718
BULC-718 Each

Single Frequency type Ultrasonic Cleaner BULC-718

Sign In for Pricing
View Details
neurobeachin like 1 (NBEAL1) Human Gene Knockout Kit (CRISPR)
KN426956 1 Kit

neurobeachin like 1 (NBEAL1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ANHX activation kit by CRISPRa
GA118808 1 Kit

Human ANHX activation kit by CRISPRa

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI7B4]
CF807995 100 µg

PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI7B4]

Sign In for Pricing
View Details
Shprh Mouse Gene Knockout Kit (CRISPR)
KN515763 1 Kit

Shprh Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details