Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage If1 Virion export protein (IV)

This Recombinant Enterobacteria phage If1 Virion export protein (IV) spans the amino acid sequence from region 19-429.

Product Specifications

Product Name Alternative

Virion export protein, Gene 4 protein, G4P

UniProt

O80300

Expression Region

19-429

Origin

Enterobacteria phage If1 (Bacteriophage If1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IPVELNNAPVREFVSWYSKTTGKPVIISPDVKGEITVYSADVTKDELPQFFTSVLRANGF DLSPGNPAVVQKFNRNTYEYSDSFSEPVPASSYDGDVPPPTGDFFTKPEIRANLITQTYP VNNVRAKDLAPVIDIFLKGENIAGTKVYPLMGRIFLLVTASASQHKELAAFFPSVDVPRT QVLVESVIFETTASDGFDFSFAAGDPSGSPVAGGINTDRLTSVLSSTGGSFGIFNGNILG LSLKALETSSKSTLLSMPRILTMSGQPGTFTAGQNVPFVTGRVTGEAANVNNPFQTIERH DVGISLKVVPVVTPGGLLIMDVSTNADSISDSQTASDIITNTRSISTTVQLKSGQTVLLG GMVDNRESDSDSSVPWVSKIPLIGALFTSKSSNANKRTLYILIRARVVNLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF594 conjugate, 0.1mg/mL
BNC942554-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Human CD46 Antibody[TRA-2-10]
AN00324E-01 20 Tests

APC Anti-Human CD46 Antibody[TRA-2-10]

Sign In for Pricing
View Details
APC Anti-Human CD46 Antibody[TRA-2-10]
AN00324E-02 100 Tests

APC Anti-Human CD46 Antibody[TRA-2-10]

Sign In for Pricing
View Details
APC Anti-Human CD46 Antibody[TRA-2-10]
AN00324E-03 2x 100 Tests

APC Anti-Human CD46 Antibody[TRA-2-10]

Sign In for Pricing
View Details
Dysferlin (DYSF) (C-term) Rabbit Polyclonal Antibody
AP31052PU-N 250 µL

Dysferlin (DYSF) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabex5 (RABGEF1) (NM_014504) Human Over-expression Lysate
LY402344 100 µg

Rabex5 (RABGEF1) (NM_014504) Human Over-expression Lysate

Sign In for Pricing
View Details