Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein CNPPD1 (CNPPD1)

This Recombinant Bovine Protein CNPPD1 (CNPPD1) spans the amino acid sequence from region 1-411.

Product Specifications

Product Name Alternative

Protein CNPPD1

UniProt

Q5E9J2

Expression Region

1-411

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLAGLLLDEEGTFSLTGFQDFTFLPGHQKLSARIRRRLYYGWDWETDCTLEELSSPVAD IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWRLYTDPRE IFEVLSWLEGCVAEQQGRRRGWYTYTDLCVLLEQPAWQLVLGSLCQQLAKLSCLLAMAYV SSVALAVASMAVIHQSLGLSCSPPPGPPDLGLASRCLLEPCIPSPMPQCLPSPANASGCL EGNVVLRSLWGSLLVSLTPPPLPPPDPPAPPILLHNCPLCQKLQKDSPTCRACHHLNHTV PTGPPSPWSHSHGLAPPWPWSPMPPLLPQPQQCSLFSIMELARLKSFIFPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtf2b (NM_145546) Mouse Tagged Lenti ORF Clone
MR204535L4 10 µg

Gtf2b (NM_145546) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
c-Abl Rabbit mAb
A22199 100 µL

c-Abl Rabbit mAb

Sign In for Pricing
View Details
Nalgene Nylon MF75 500ml 0.2um Filter Unit
FIL8126 10 / PCK

Nalgene Nylon MF75 500ml 0.2um Filter Unit

Sign In for Pricing
View Details
SEMA4A Rabbit Polyclonal Antibody
APRab17717-01 20 µL

SEMA4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SEMA4A Rabbit Polyclonal Antibody
APRab17717-02 50 µL

SEMA4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SEMA4A Rabbit Polyclonal Antibody
APRab17717-03 100 µL

SEMA4A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details