Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Protrudin (ZFYVE27)

This Recombinant Pongo abelii Protrudin (ZFYVE27) spans the amino acid sequence from region 1-411.

Product Specifications

Product Name Alternative

Protrudin, Zinc finger FYVE domain-containing protein 27

UniProt

Q5R7K2

Expression Region

1-411

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDG VRYLLRWQMPLCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPES ELMRRKYHSVRQEDLQRVRLSRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPV VSSQFYGALLGTICMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEYRASLQQRMNPKQEE HAFESPPPPDVGGKGGLMDSTPALTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHLVVLE DDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVL KKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (6F-H2), CF640R conjugate, 0.1mg/mL
BNC400856-500 1x 500 µL

WT1 (Wilm's Tumor 1) (6F-H2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF594 conjugate, 0.1mg/mL
BNC942602-100 1x 100 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2602), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF568 conjugate, 0.1mg/mL
BNC680705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (B22.1), CF405S conjugate, 0.1mg/mL
BNC041219-100 1x 100 µL

Cytokeratin 8 (B22.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details