Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum Protein HflK (hflK)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum Protein HflK (hflK) spans the amino acid sequence from region 1-411.

Product Specifications

Product Name Alternative

Protein HflK

UniProt

Q8K914

Expression Region

1-411

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAWNKFNNSEPELDPWGKKNSQEKNGSKNKDDRKNHEKIITLDFKKFLYNINNIFNKTNN SQNLSKNKINPFLIIAFVSFFVWCFSGFYTIKEAERGVVTTFGKFSHLVAPGLNWRPVFI NEVKAVNVETVRELATSGVMLTSDENVVRVEMNVQYKITDPADYLFSVAYPDDSLRQATD SALRGVIGHSNMDRVLTEGRTLIRSDTQKEIEETIKPYKLGITILDVNFQTARPPEEVKE AFDDAIAARENREQYIREAEAYSNEVQPKAHGKAQRILEEAKAYSSRRILEAQGEVVRFL KILPEYRKNKEMTLKRLYIESMEKLLSKTKKIFIDKKNHSKLFLSLNNFFHQDKFNKQDL FNNPINLSKNHSCSFQKNKEINDVSSLPPSDFFKKRRIESIRTNIKNIERE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-100 1x 100 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-100 1x 100 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-100 1x 100 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-500 1x 500 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details