Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsule biosynthesis protein CapA (capA)

This Recombinant Capsule biosynthesis protein CapA (capA) spans the amino acid sequence from region 1-411.

Product Specifications

Product Name Alternative

Capsule biosynthesis protein CapA

UniProt

P19579

Expression Region

1-411

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRRKLTFQEKLLIFIKKTKKKNPRYVAIVLPLIAVILIAATWVQRTEAVAPVKHRENEKL TMTMVGDIMMGRHVKEIVNRYGTDYVFRHVSPYLKNSDYVSGNFEHPVLLEDKKNYQKAD KNIHLSAKEETVKAVKEAGFTVLNLANNHMTDYGAKGTKDTIKAFKEADLDYVGAGENFK DVKNIVYQNVNGVRVATLGFTDAFVAGAIATKEQPGSLSMNPDVLLKQISKAKDPKKGNA DLVVVNTHWGEEYDNKPSPRQEALAKAMVDAGADIIVGHHPHVLQSFDVYKQGIIFYSLG NFVFDQGWTRTKDSALVQYHLRDNGTAILDVVPLNIQEGSPKPVTSALDKNRVYRQLTKD TSKGALWSKKDDKLEIKLNHKHVIEKMKKREKQEHQDKQEKENQVSVETTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BTG4 Antibody [Allophycocyanin]
NBP3-05926APC 0.1 mL

Rabbit Polyclonal BTG4 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
T-cell surface glycoprotein CD5
MBS7042470-01 0.02 mg

T-cell surface glycoprotein CD5

Sign In for Pricing
View Details
T-cell surface glycoprotein CD5
MBS7042470-02 0.1 mg

T-cell surface glycoprotein CD5

Sign In for Pricing
View Details
T-cell surface glycoprotein CD5
MBS7042470-03 5x 0.1 mg

T-cell surface glycoprotein CD5

Sign In for Pricing
View Details
Zfp112 Mouse siRNA Oligo Duplex (Locus ID 57745)
SR420957 1 Kit

Zfp112 Mouse siRNA Oligo Duplex (Locus ID 57745)

Sign In for Pricing
View Details
RPL21P37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
41039061 1.0 µg DNA

RPL21P37 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details