Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Abhydrolase domain-containing protein 1 (Abhd1)

This Recombinant Rat Abhydrolase domain-containing protein 1 (Abhd1) spans the amino acid sequence from region 1-412.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 1, EC= 3.1.1.-

UniProt

Q5RK23

Expression Region

1-412

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYLHITKMLSSSLSPQNGTWSDAISLLLALGIALYLGYYWACVPQRPRLVAGPQFLAFL EQHCPVTVETFYPTLWCFEGRLQTIFRVLLQSQPVIPYRSEVLQTPDGGQFLLDWAEQPY SSHCPDPTTQPIVLLLPGISGSSQEPYILHLVDQALKDGYRAVVFNNRGCRGEELLTHRA YCASNTEDLETVVKHIKHRYSRAPLLAVGISFGGILVLNYLARTGKAGGLVAGLTMSACW DSFETVDSLETPLNSLLFNQPLTAGLCRLVARNRKSIEKVLDVDFAIKARTIRQLDERYT SVAFGYKDCAAYYHASSPRTKVDAICTPVLCLNAADDPFSPVQALPLQAAQKSPYVALLI TARGGHIGFLEGLLPWQHCYMNRVLHQYARAVFQHSVGLPGLGALTPEDGKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-100 1x 100 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-500 1x 500 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF647 conjugate, 0.1mg/mL
BNC470164-100 1x 100 µL

CD28 (204.12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details