Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R474 (MIMI_R474)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R474 (MIMI_R474) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Uncharacterized protein R474

UniProt

Q5UQE2

Expression Region

1-413

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNISIESQLINYCLLFFTVVIIPIFYYIYKIVYLYLSHKLRESLINTSARIFKENESFVK QIIFTITDGVGNLRQDIMDHLQYRQTCNSIKYIVDKVFVLIDNISAIYSNTPVENYNYQY CDNITPVQPLGCGAYCPYYQPYDATFNPDCNLNYDTIYNFDFDKDIIKCDNTSECSETNE TNKNTSHKLKFEYPKRCRKSRRNSRVFSRNFLKTKKSRENNSKTSTTEPFACTKDETTGM YTIKSNAYDTKNSTETNSDNNSEIVSETNSETNYSTPTTAKVNIDDVLAAMTTVYDKSDF GLNDKIKENVADSLKKMCDSSGNIKVDFDDQKLFKTVFDSVYQGLMTDPSIVDNSGYSSP TNESLNGSLTETLNESLNGSFDNSINNIKETLNKSLMDFIDCPSGSINFSNKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FHL1 (NM_001159701) Human Recombinant Protein
TP328243M 100 µg

FHL1 (NM_001159701) Human Recombinant Protein

Sign In for Pricing
View Details
Serum Amyloid A (SAA/2868R), CF647 conjugate, 0.1mg/mL
BNC472868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MBNL1 (NM_021038) Human Over-expression Lysate
LC402822 20 µg

MBNL1 (NM_021038) Human Over-expression Lysate

Sign In for Pricing
View Details
SPRYD3 (NM_032840) Human Recombinant Protein
TP312360L 1 mg

SPRYD3 (NM_032840) Human Recombinant Protein

Sign In for Pricing
View Details
GAGE2B (NM_001098411) Human Over-expression Lysate
LY420575 100 µg

GAGE2B (NM_001098411) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ETV7 activation kit by CRISPRa
GA109845 1 Kit

Human ETV7 activation kit by CRISPRa

Sign In for Pricing
View Details