Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM8A1 (FAM8A1)

This Recombinant Human Protein FAM8A1 (FAM8A1) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Protein FAM8A1, Autosomal highly conserved protein

UniProt

Q9UBU6

Expression Region

1-413

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEGPEEARGHPPGQDDGGGDHEPVPSLRGPPTTAVPCPRDDPQAEPQAPGRPTAPGLAA AAAADKLEPPRELRKRGEAASGSGAELQEQAGCEAPEAAAPRERPARLSAREYSRQVHEW LWQSYCGYLTWHSGLAAFPAYCSPQPSPQSFPSGGAAVPQAAAPPPPQLGYYNPFYFLSP GAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSETGRQAGRE YVIPSLAHRFMAEMVDFFILFFIKATIVLSIMHLSGIKDISKFAMHYIIEEIDEDTSMED LQKMMVVALIYRLLVCFYEIICIWGAGGATPGKFLLGLRVVTCDTSVLIAPSRVLVIPSS NVSITTSTIRALIKNFSIASFFPAFITLLFFQHNRTAYDIVAGTIVVKRNGVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-100 1x 100 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/2960R), CF405S conjugate, 0.1mg/mL
BNC042960-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/2960R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (IM373), CF640R conjugate, 0.1mg/mL
BNC400373-500 1x 500 µL

Human IgM Immunoglobulin (IM373), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details