Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sensor protein CutS (cutS)

This Recombinant Sensor protein CutS (cutS) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Sensor protein CutS, EC= 2.7.13.3

UniProt

P0A4I8

Expression Region

1-414

Origin

Streptomyces lividans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATTPAPPGAPPKPTWDPRSATPLPWLRPTIRIRLTLLYGGMFLIAGILLLSIIYLLAAQ AVRTGNEPLYKIVDFTDLKVSSSTCPVVDNGGLSLSDFNAAISDCMDHQRKVALDNLLSR SLLALLGLAVIAFAFGYAMAGRVLSPLGRITRTARAVAGSDLSRRIELDGPDDELKELAD TFDDMLERLQRAFTAQQRFVGNASHELRTPLAINRTLLEVHLSDPGAPVELQQLGKTLLA TNERSELLVEGLLLLARSDNQIVERKPVDLAEVAGQAIDQVHAEAESKGVEVRGTREAAV VQGNGVLLERIALNLVQNAVRYNVAGQGWVEVATAVENGQAVLVVTNTGPVVPAYEVDNL FEPFRRLRTERTGSDKGVGLGLSIARSVARAHGGHISAQPREGGGLVMRVTLPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT10, NT (PRMT10, Putative protein arginine N-methyltransferase 10) (APC) discontinued
040469-APC 200 µL

PRMT10, NT (PRMT10, Putative protein arginine N-methyltransferase 10) (APC) discontinued

Sign In for Pricing
View Details
USP25, NT (Ubiquitin Carboxyl-terminal Hydrolase 25, Ubiquitin Thiolesterase 25, Ubiquitin-specific-processing Protease 25, Deubiquitinating Enzyme 25, USP on Chromosome 21, USP21) (AP) discontinued
U4101-25A-AP 200 µL

USP25, NT (Ubiquitin Carboxyl-terminal Hydrolase 25, Ubiquitin Thiolesterase 25, Ubiquitin-specific-processing Protease 25, Deubiquitinating Enzyme 25, USP on Chromosome 21, USP21) (AP) discontinued

Sign In for Pricing
View Details
Transcriptional regulator MraZ (mraZ)
PX-P4518-100 100 µg

Transcriptional regulator MraZ (mraZ)

Sign In for Pricing
View Details
Anti-DUX3 Antibody
CTA5182-01 30 µL

Anti-DUX3 Antibody

Sign In for Pricing
View Details
Anti-DUX3 Antibody
CTA5182-02 50 μL

Anti-DUX3 Antibody

Sign In for Pricing
View Details
Anti-DUX3 Antibody
CTA5182-03 100 µL

Anti-DUX3 Antibody

Sign In for Pricing
View Details