Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptomyces coelicolor Sensor protein CutS (cutS)

This Recombinant Streptomyces coelicolor Sensor protein CutS (cutS) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Sensor protein CutS, EC= 2.7.13.3

UniProt

P0A4I7

Expression Region

1-414

Origin

Streptomyces coelicolor (strain ATCC BAA-471 / A3 (2) / M145)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATTPAPPGAPPKPTWDPRSATPLPWLRPTIRIRLTLLYGGMFLIAGILLLSIIYLLAAQ AVRTGNEPLYKIVDFTDLKVSSSTCPVVDNGGLSLSDFNAAISDCMDHQRKVALDNLLSR SLLALLGLAVIAFAFGYAMAGRVLSPLGRITRTARAVAGSDLSRRIELDGPDDELKELAD TFDDMLERLQRAFTAQQRFVGNASHELRTPLAINRTLLEVHLSDPGAPVELQQLGKTLLA TNERSELLVEGLLLLARSDNQIVERKPVDLAEVAGQAIDQVHAEAESKGVEVRGTREAAV VQGNGVLLERIALNLVQNAVRYNVAGQGWVEVATAVENGQAVLVVTNTGPVVPAYEVDNL FEPFRRLRTERTGSDKGVGLGLSIARSVARAHGGHISAQPREGGGLVMRVTLPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Conjugated Goat Affinity Purified Antibody to Human IgG,
BAF-001-2 2 mL

Biotin Conjugated Goat Affinity Purified Antibody to Human IgG,

Sign In for Pricing
View Details
Anti-A Phaseolus lunatus Lectin (Lima Bean) -LBA-
B-1701-2 2 mL

Anti-A Phaseolus lunatus Lectin (Lima Bean) -LBA-

Sign In for Pricing
View Details
cis-3'-Hydroxy Cotinine
TRC-H924505-10MG 10 mg

cis-3'-Hydroxy Cotinine

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-
LA-7401-1 1 mg

Alkaline Phosphatase Conjugated Galanthus nivalis Lectin (Snowdrop Bulb) -GNA-

Sign In for Pricing
View Details
rac 2-Hydroxy Ibuprofen
TRC-H942860-1MG 1 mg

rac 2-Hydroxy Ibuprofen

Sign In for Pricing
View Details
RMND5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D1]
TA803152AM 100 µL

RMND5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D1]

Sign In for Pricing
View Details