Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptomyces coelicolor Sensor protein CutS (cutS)

This Recombinant Streptomyces coelicolor Sensor protein CutS (cutS) spans the amino acid sequence from region 1-414.

Product Specifications

Product Name Alternative

Sensor protein CutS, EC= 2.7.13.3

UniProt

P0A4I7

Expression Region

1-414

Origin

Streptomyces coelicolor (strain ATCC BAA-471 / A3 (2) / M145)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATTPAPPGAPPKPTWDPRSATPLPWLRPTIRIRLTLLYGGMFLIAGILLLSIIYLLAAQ AVRTGNEPLYKIVDFTDLKVSSSTCPVVDNGGLSLSDFNAAISDCMDHQRKVALDNLLSR SLLALLGLAVIAFAFGYAMAGRVLSPLGRITRTARAVAGSDLSRRIELDGPDDELKELAD TFDDMLERLQRAFTAQQRFVGNASHELRTPLAINRTLLEVHLSDPGAPVELQQLGKTLLA TNERSELLVEGLLLLARSDNQIVERKPVDLAEVAGQAIDQVHAEAESKGVEVRGTREAAV VQGNGVLLERIALNLVQNAVRYNVAGQGWVEVATAVENGQAVLVVTNTGPVVPAYEVDNL FEPFRRLRTERTGSDKGVGLGLSIARSVARAHGGHISAQPREGGGLVMRVTLPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant GSDME Monoclonal Antibody
E-AB-81466-01 50 µL

Recombinant GSDME Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant GSDME Monoclonal Antibody
E-AB-81466-02 100 µL

Recombinant GSDME Monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS706903 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793Q-01 25 µg

Elab Fluor® Violet 450 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793Q-02 100 µg

Elab Fluor® Violet 450 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
TSSK1 (TSSK1B) (NM_032028) Human Over-expression Lysate
LC403140 20 µg

TSSK1 (TSSK1B) (NM_032028) Human Over-expression Lysate

Sign In for Pricing
View Details