TFF1, Human
TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human is the recombinant human-derived TFF1 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
TFF1 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tff1-protein-human.html
Purity
97.00
Smiles
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Molecular Formula
7031 (Gene_ID) P04155 (E25-F84) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Beta I Tubulin Recombinant Antibody, PerCP-Cy5.5 Conjugated
MCM10 Exon 14 Knockout Stable HCT116 Cell Line (Clone 14)
TIM 3 (HAVCR2) Mouse Monoclonal Antibody [Clone ID: OTI2C11]
![Rabbit Polyclonal Pygopus-2 Antibody [DyLight 488]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)