Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF1, Human

TFF1 protein functions as a mucous gel stabilizer, vital for fortifying the gastrointestinal mucosa against noxious agents. It contributes to the mucous layer's integrity, providing a crucial physical barrier for the gastrointestinal tract, safeguarding it from potential harm. TFF1's stabilizing role emphasizes its significance in preserving the mucosal barrier, essential for overall gastrointestinal health and protection. TFF1 Protein, Human is the recombinant human-derived TFF1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

TFF1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tff1-protein-human.html

Purity

97.00

Smiles

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

Molecular Formula

7031 (Gene_ID) P04155 (E25-F84) (Accession)

Molecular Weight

Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rsrc2 (NM_001005523) Mouse Tagged ORF Clone
MG222696 10 µg

Rsrc2 (NM_001005523) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HOXB7 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23823154 3x 1.0 µg DNA

HOXB7 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Pipoxolan (free base)
T69661-01 25 mg

Pipoxolan (free base)

Sign In for Pricing
View Details
Pipoxolan (free base)
T69661-02 50 mg

Pipoxolan (free base)

Sign In for Pricing
View Details
Pipoxolan (free base)
T69661-03 100 mg

Pipoxolan (free base)

Sign In for Pricing
View Details
CAST (Calpastatin, Calpain Inhibitor, Sperm BS-17 Component) (MaxLight 405)
MBS6189237-01 0.1 mL

CAST (Calpastatin, Calpain Inhibitor, Sperm BS-17 Component) (MaxLight 405)

Sign In for Pricing
View Details