Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Protrudin (Zfyve27)

This Recombinant Mouse Protrudin (Zfyve27) spans the amino acid sequence from region 1-415.

Product Specifications

Product Name Alternative

Protrudin, Zinc finger FYVE domain-containing protein 27

UniProt

Q3TXX3

Expression Region

1-415

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQTSDRDLSGPEASPSGMPEVLSECPPAPTKSAAFDLFNLVLSYKRLEIYLEPLKDAGDG VRYLLRWQMPLCSLLTCLGLNILFLTLNEGAWYSMGALMISVPALLGYLQEVCRGQLPES ELMRRKYHSIRQEDLQRVRLSRVHLSRPEAVAEVKSFLIQLEAFLARLCYTCESAYRVLH WENPVVSSQFYGALLGMVCMLYLLPLCWVLALLNSTLFLGNGDFFRVVCEYRACLQRRMN PRQEECACESSALQGAGGRGLLDSSPAPTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHL VVLEDEEGTPCPAEDELTLQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCAGCAAT FSVLKKRRSCSNCGNSFCSRCCSFKVPRSSMGATAPEAQRETVCVCASCNQTLSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF488A conjugate, 0.1mg/mL
BNC882145-500 1x 500 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2145), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF647 conjugate, 0.1mg/mL
BNC471561-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), CF640R conjugate, 0.1mg/mL
BNC400687-100 1x 100 µL

Cytokeratin 8 (H1 + TS1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details