Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat coronavirus Hemagglutinin-esterase (HE)

This Recombinant Rat coronavirus Hemagglutinin-esterase (HE) spans the amino acid sequence from region 25-439.

Product Specifications

Product Name Alternative

Hemagglutinin-esterase, HE protein, EC= 3.1.1.53, E3 glycoprotein

UniProt

Q9IKD2

Expression Region

25-439

Origin

Rat coronavirus (strain 681) (RCV-SDAV) (Sialodacryoadenitis virus SDAV-681)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FNEPINIVSHLNDDWFLFGDSRSDCTYVENNGHPKLDWLDLDPKLCNSGKIAAKSGNSLF RSFHFTDFYNYTGEGDQIIFYEGVSFSPSHGFKCLVEGDNNKWMGNKARFYALLYKKMAQ YRSLSFVTVPYAYGGNAKPTSICKDKTLTLNNPTFISKESNYVDYYYVSEANFTLQGCDE FIVPLCVFNGHSRGSSSDPANKYYTDSQSYYNIDTGVLYGFNSTLDVGNTAQNPGLDLTC MYLVLTPGNYKAVSLEYLLTIPSKAICLRKPKRFMPVQVVDSRWNSTRQSDNMTAVACQL PYCFFRNTSADYSGDTHDVHHGDFYFRQLLSGLLYNVSCIAQQGAFLYNNVSSIWPVYGY GHCPTAANIGYMAPVCLYDPLPVILLGVLLGIAVLIIVFLILYFMADSSVRLHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Endoglin / CD105 (ENG/1621), CF405S conjugate, 0.1mg/mL
BNC041621-500 1x 500 µL

Endoglin / CD105 (ENG/1621), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details