Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage I2-2 Attachment protein G3P (III)

This Recombinant Enterobacteria phage I2-2 Attachment protein G3P (III) spans the amino acid sequence from region 20-434.

Product Specifications

Product Name Alternative

Attachment protein G3P, Gene 3 protein, G3P, Minor coat protein

UniProt

P15415

Expression Region

20-434

Origin

Enterobacteria phage I2-2 (Bacteriophage I2-2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DNWESITKSYYTGFAMSKTVESKDQDGKTVRKEVITQADLTTACNDAKASAQDVFNQMKL TFSGIWPDSQFRLVTGDTCVYNGSPSEKTESWSIRAQVEGDMQRSVPDEEPSEQTPEEIC EAKPPIDGVFNNVSKGDEGGFYINYNGCEYEATGVTVCQNDGTVCASSAWKPTGYVPESG ESSSSPVKDGDTGGTGEGGSDTGGDTGGGDTGGGSTGGDTGGSTGGGSTGGGSTGGSTGK SLTKEDVTAAIHDASPSIGDAVKDSLTEDNDQNDNQKKADEQSAKASASVSDAISDGMRG VGNFVDDLGGESSQYGIGNSEMDLSVSLAKGQLGIDLEGHGSAWESFLNDGALRPSIPSG HGCTDFVMFQGSVYQLDIGCDKLGDIKSVLSWVMYCLTFWYVFQSATSLLRKGEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SYP/Synaptophysin Antibody Picoband® (monoclonal, 3G12) Fluoro488 Conjugated
M05049-3-Fluoro488 100 µg/Vial

Anti-SYP/Synaptophysin Antibody Picoband® (monoclonal, 3G12) Fluoro488 Conjugated

Sign In for Pricing
View Details
At3g47420 Antibody
orb789549 2 mg

At3g47420 Antibody

Sign In for Pricing
View Details
PAC4 Lentiviral Activation Particles (m)
sc-427487-LAC 200 µL

PAC4 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
C9orf46 sgRNA CRISPR Lentivector (Human) (Target 1)
K0266602 1.0 µg DNA

C9orf46 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Hic1 qPCR Primer Pair
QM14686S 200 Tests

Mouse Hic1 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal Transglutaminase 7/TGM7 Antibody [HRP]
NBP2-81763H 0.1 mL

Rabbit Polyclonal Transglutaminase 7/TGM7 Antibody [HRP]

Sign In for Pricing
View Details