Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage I2-2 Attachment protein G3P (III)

This Recombinant Enterobacteria phage I2-2 Attachment protein G3P (III) spans the amino acid sequence from region 20-434.

Product Specifications

Product Name Alternative

Attachment protein G3P, Gene 3 protein, G3P, Minor coat protein

UniProt

P15415

Expression Region

20-434

Origin

Enterobacteria phage I2-2 (Bacteriophage I2-2)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DNWESITKSYYTGFAMSKTVESKDQDGKTVRKEVITQADLTTACNDAKASAQDVFNQMKL TFSGIWPDSQFRLVTGDTCVYNGSPSEKTESWSIRAQVEGDMQRSVPDEEPSEQTPEEIC EAKPPIDGVFNNVSKGDEGGFYINYNGCEYEATGVTVCQNDGTVCASSAWKPTGYVPESG ESSSSPVKDGDTGGTGEGGSDTGGDTGGGDTGGGSTGGDTGGSTGGGSTGGGSTGGSTGK SLTKEDVTAAIHDASPSIGDAVKDSLTEDNDQNDNQKKADEQSAKASASVSDAISDGMRG VGNFVDDLGGESSQYGIGNSEMDLSVSLAKGQLGIDLEGHGSAWESFLNDGALRPSIPSG HGCTDFVMFQGSVYQLDIGCDKLGDIKSVLSWVMYCLTFWYVFQSATSLLRKGEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caulobacter crescentus Protein MraZ (mraZ)
MBS1226643-01 0.02 mg (E-Coli)

Recombinant Caulobacter crescentus Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus Protein MraZ (mraZ)
MBS1226643-02 0.1 mg (E-Coli)

Recombinant Caulobacter crescentus Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus Protein MraZ (mraZ)
MBS1226643-03 0.02 mg (Yeast)

Recombinant Caulobacter crescentus Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus Protein MraZ (mraZ)
MBS1226643-04 0.1 mg (Yeast)

Recombinant Caulobacter crescentus Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus Protein MraZ (mraZ)
MBS1226643-05 0.02 mg (Baculovirus)

Recombinant Caulobacter crescentus Protein MraZ (mraZ)

Sign In for Pricing
View Details
Recombinant Caulobacter crescentus Protein MraZ (mraZ)
MBS1226643-06 0.02 mg (Mammalian-Cell)

Recombinant Caulobacter crescentus Protein MraZ (mraZ)

Sign In for Pricing
View Details