Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

This Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1) spans the amino acid sequence from region 1-416.

Product Specifications

Product Name Alternative

Mitochondrial inner membrane i-AAA protease complex subunit MGR1, Mitochondrial genome-required protein 1

UniProt

A6ZTE8

Expression Region

1-416

Origin

Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVFTPPSGNSNSTDHTHTQDDHDKDDNDIKKFYIRPSLGLKLWGPLVPAPDNLPGLYTL ITIQSAVGFFALWRLRRLYKLPPPRRIATGTHSDLSFGELPSEMIVNGKTKIKKDIADFP TLNRFSTTHGDIVLAPPPIIPRQSRFVSVRKLLWGLFGSLLLSQSLLELTRLNFLKYDPW CDEMKSVRDKKFFNNIVKYYHEGIDPTKIKVKDAMNGTPLSTNIPEVKQSVALARAQVEA QNPIIKWFGPLEYKPMSFNEYLNRMEFHLDMFEFFQNKRNIRENSIELINSISHNPQSSS TGLEGLSESKKLHLQNVEKRLHFLASSGDSISAPVKRSSTTLSRGVILPHDTKGPQDIDL DTIRSLYDPWMTLALETSLSIKFIPTTMPSHTKTPTSTDQPLPGPTPKALTNEKTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUF2 Rabbit Polyclonal Antibody
orb629463-01 50 µg

NUF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUF2 Rabbit Polyclonal Antibody
orb629463-02 100 µg

NUF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LGALS9 Antibody Blocking Peptide
orb1510521 500 µg

LGALS9 Antibody Blocking Peptide

Sign In for Pricing
View Details
beta Arrestin 1 (ARRB1) (NM_004041) Human 3' UTR Clone
SC209297 10 µg

beta Arrestin 1 (ARRB1) (NM_004041) Human 3' UTR Clone

Sign In for Pricing
View Details
Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) Polyclonal Antibody
CAU24051-01 100 µL

Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) Polyclonal Antibody

Sign In for Pricing
View Details
Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) Polyclonal Antibody
CAU24051-02 200 µL

Zona Pellucida Glycoprotein 2, Sperm Receptor (ZP2) Polyclonal Antibody

Sign In for Pricing
View Details