Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Squalene synthase (fdfT)

This Recombinant Dictyostelium discoideum Squalene synthase (fdfT) spans the amino acid sequence from region 1-416.

Product Specifications

Product Name Alternative

Squalene synthase, SQS, SS, EC= 2.5.1.21, FPP:FPP farnesyltransferase, Farnesyl-diphosphate farnesyltransferase

UniProt

Q54DR1

Expression Region

1-416

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYMKSLAHPDEFLSLLKIGYTESFKPKSQLKENLGNKEWCYELLNKTSRSFAFVINELE PSLKDAICIFYLVLRGLDTIEDDTTVELNTKLPVLTSFSEGLYQPGYKVFGYGMNNDEKN LVENFDKVVDVFLGLGDGYCTIIHDITRRMANGMSEFLQKSVVTLPEWDLYCHYVAGLVG IGLSKIFHASGLESEWFATADDESNQMGLFLQKTNIIRDYLEDINEKRIFWPRDVWARYT LHLENFKEAKYQIPALHCLNDLITNALSHALIALDYMSRLKNPQVINFCAIPQVMAIGTL NACYNNYNVFTGVVKIRKGQRALIVDAIQSKGLTATYELFFKFANEMRHKVPPNDPSAKK TIQHLESIEKLCIEKLGYRPSGFNDFISYDWMAVTSLAVSSAFLIARHGPNFFSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNFT1 (LOC51136, RING Finger and Transmembrane Domain-containing Protein 1, Protein PTD016, PTD016, MGC111090) (HRP)
129170-HRP 100 µL

RNFT1 (LOC51136, RING Finger and Transmembrane Domain-containing Protein 1, Protein PTD016, PTD016, MGC111090) (HRP)

Sign In for Pricing
View Details
Bovine BMP4/Bone morphogenetic protein 4 ELISA Kit
orb1662280 96 Tests

Bovine BMP4/Bone morphogenetic protein 4 ELISA Kit

Sign In for Pricing
View Details
CAMKV (NM_024046) Human Over-expression Lysate
LS079012-100ug 100 µg

CAMKV (NM_024046) Human Over-expression Lysate

Sign In for Pricing
View Details
SARS-CoV-2 Recombinant Spike Glycoprotein (S2)
MBS412777-01 0.5 mg

SARS-CoV-2 Recombinant Spike Glycoprotein (S2)

Sign In for Pricing
View Details
SARS-CoV-2 Recombinant Spike Glycoprotein (S2)
MBS412777-02 5x 0.5 mg

SARS-CoV-2 Recombinant Spike Glycoprotein (S2)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Deoxythymidylate Kinase (DTYMK)
MBS2136137-01 0.1 mL

Biotin Linked Monoclonal Antibody to Deoxythymidylate Kinase (DTYMK)

Sign In for Pricing
View Details