Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Squalene synthase (fdfT)

This Recombinant Dictyostelium discoideum Squalene synthase (fdfT) spans the amino acid sequence from region 1-416.

Product Specifications

Product Name Alternative

Squalene synthase, SQS, SS, EC= 2.5.1.21, FPP:FPP farnesyltransferase, Farnesyl-diphosphate farnesyltransferase

UniProt

Q54DR1

Expression Region

1-416

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYMKSLAHPDEFLSLLKIGYTESFKPKSQLKENLGNKEWCYELLNKTSRSFAFVINELE PSLKDAICIFYLVLRGLDTIEDDTTVELNTKLPVLTSFSEGLYQPGYKVFGYGMNNDEKN LVENFDKVVDVFLGLGDGYCTIIHDITRRMANGMSEFLQKSVVTLPEWDLYCHYVAGLVG IGLSKIFHASGLESEWFATADDESNQMGLFLQKTNIIRDYLEDINEKRIFWPRDVWARYT LHLENFKEAKYQIPALHCLNDLITNALSHALIALDYMSRLKNPQVINFCAIPQVMAIGTL NACYNNYNVFTGVVKIRKGQRALIVDAIQSKGLTATYELFFKFANEMRHKVPPNDPSAKK TIQHLESIEKLCIEKLGYRPSGFNDFISYDWMAVTSLAVSSAFLIARHGPNFFSKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reagecon Alkalinity Standard 50 mg/L (50 ppm) as CaCO3
TA0501 1 L

Reagecon Alkalinity Standard 50 mg/L (50 ppm) as CaCO3

Sign In for Pricing
View Details
EVI1/MECOM Rabbit Polyclonal Antibody (Fluoro488)
orb3105359 100 µg

EVI1/MECOM Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
CA11 Peptide
DF9335-BP 1 mg

CA11 Peptide

Sign In for Pricing
View Details
CXCL16 Polyclonal Antibody, FITC Conjugated
bs-1441R-FITC-01 20 µL

CXCL16 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
CXCL16 Polyclonal Antibody, FITC Conjugated
bs-1441R-FITC-02 100 µL

CXCL16 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Mouse Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 ELISA Kit
MBS060135-01 48 Well

Mouse Carcinoembryonic Antigen Related Cell Adhesion Molecule 7 ELISA Kit

Sign In for Pricing
View Details