Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-54 (tim-54)

This Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-54 (tim-54) spans the amino acid sequence from region 53-468.

Product Specifications

Product Name Alternative

Mitochondrial import inner membrane translocase subunit tim-54

UniProt

Q9C0Q7

Expression Region

53-468

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KLPSRNWMIFWTVSASITAAIIYDRREKRRNIAKWRHAVEHLAAEPITDKLGLEQPRKLT IYLSAPPGDGLRVAQDHYTEYVKPVLAASGLDWEFVQGRREGDVRAVVAERLRKVRRGWE NKEEQDPNREPTKDELIEIYRQQRGIKDYEGVRGDVVIGRHTWKEYLRGLHEGWLGPLVA PAEPAPLPPTPAPAAAEGSTSTEDKPAEEKKEEEAPKPKRPPQPKPYNTTSDYSSETLHP LTPQELTPAVPIREPHILGFLNTPTRMVRFFNRRSLADDIGREVAAVCLATHREFQQQTN PDAPSTDSVQYEQAKELEWEEQDWPKKVWKEDEADADKEVTEKIHIKPVVMDPRLAHRMR RFALTPEDEDRVSKIKVPEEEVEGWIKGSLRKACHWGYDKAFNKKKLVPLEDKDVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (8G7G3/1), CF594 conjugate, 0.1mg/mL
BNC940448-100 1x 100 µL

TTF-1 / NKX2.1 (8G7G3/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-100 1x 100 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details