Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Glycoprotein NB (NB)

This Recombinant Influenza B virus Glycoprotein NB (NB) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Glycoprotein NB

UniProt

P16204

Expression Region

1-100

Origin

Influenza B virus (strain B/Singapore/222/1979)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNATFNYTNVNPISHIRGSVIITICVSFTVILTVFGYIAKIFTNKKNCTNNVIGLRERI KCSGCEPFCNKRDDISSPRTGVDIPSFILPGLNLSESTPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynamin 1 Mouse Monoclonal Antibody [A1B2]
EM1901-42 100 µL

Dynamin 1 Mouse Monoclonal Antibody [A1B2]

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL
BNC882298-100 1x 100 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF405S conjugate, 0.1mg/mL
BNC042462-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2462), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DLG4 Polyclonal Antibody
E-AB-70135-01 60 µL

DLG4 Polyclonal Antibody

Sign In for Pricing
View Details
DLG4 Polyclonal Antibody
E-AB-70135-02 120 µL

DLG4 Polyclonal Antibody

Sign In for Pricing
View Details
DLG4 Polyclonal Antibody
E-AB-70135-03 200 µL

DLG4 Polyclonal Antibody

Sign In for Pricing
View Details