Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza B virus Glycoprotein NB (NB)

This Recombinant Influenza B virus Glycoprotein NB (NB) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Glycoprotein NB

UniProt

P16204

Expression Region

1-100

Origin

Influenza B virus (strain B/Singapore/222/1979)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNATFNYTNVNPISHIRGSVIITICVSFTVILTVFGYIAKIFTNKKNCTNNVIGLRERI KCSGCEPFCNKRDDISSPRTGVDIPSFILPGLNLSESTPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody
TA372387 100 µL

Cytochrome b c1 complex subunit 9 (UQCR10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UBA3 Recombinant Mouse Monoclonal Antibody [1B6-6-5-R]
HA601205 100 µL

UBA3 Recombinant Mouse Monoclonal Antibody [1B6-6-5-R]

Sign In for Pricing
View Details
Axin 1 (AXIN1) (850-862) Goat Polyclonal Antibody
AP08956PU-N 50 µg

Axin 1 (AXIN1) (850-862) Goat Polyclonal Antibody

Sign In for Pricing
View Details
ASAH2 (C-term) Rabbit Polyclonal Antibody
AP23470PU-N 50 µg

ASAH2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDCD1 / PD1 / CD279 (Programmed Cell Death 1), 0.2mg/mL
BNUB1457-100 1x 100 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1), 0.2mg/mL

Sign In for Pricing
View Details
HLA-DRB (HLA-DRB/1067), CF647 conjugate, 0.1mg/mL
BNC471067-100 1x 100 µL

HLA-DRB (HLA-DRB/1067), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details