Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein elaB (elaB)

This Recombinant Escherichia coli Protein elaB (elaB) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Protein elaB

UniProt

P0AEH5

Expression Region

1-101

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNQFGDTRIDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASDS YYYRAKQAVYRADDYVHEKPWQGIGVGAAVGLVLGLLLARR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Lung
CD563843 5 µg

Tissue Genomic DNA, Lung

Sign In for Pricing
View Details
N-Boc-hydroxylamine
TRC-B656470-5G 5 g

N-Boc-hydroxylamine

Sign In for Pricing
View Details
Bulk Human IgG1 (IB1) Isotype Control LALA
ICH2254LALA-5mg 5 mg

Bulk Human IgG1 (IB1) Isotype Control LALA

Sign In for Pricing
View Details
Blk Mouse Gene Knockout Kit (CRISPR)
KN502176 1 Kit

Blk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Yeast Viability Staining Kit (Far-Red/Red)
#31063-3 1 Kit

Yeast Viability Staining Kit (Far-Red/Red)

Sign In for Pricing
View Details
Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)
KN218041 1 Kit

Collagen II (COL2A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details