Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein elaB (elaB)

This Recombinant Escherichia coli Protein elaB (elaB) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Protein elaB

UniProt

P0AEH5

Expression Region

1-101

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNQFGDTRIDDDLTLLSETLEEVLRSSGDPADQKYVELKARAEKALDDVKKRVSQASDS YYYRAKQAVYRADDYVHEKPWQGIGVGAAVGLVLGLLLARR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acesulfame Aspartame Salt
TRC-A132520-500MG 500 mg

Acesulfame Aspartame Salt

Sign In for Pricing
View Details
TCF7 Polyclonal Antibody
E-AB-53275-01 20 µL

TCF7 Polyclonal Antibody

Sign In for Pricing
View Details
TCF7 Polyclonal Antibody
E-AB-53275-02 60 µL

TCF7 Polyclonal Antibody

Sign In for Pricing
View Details
TCF7 Polyclonal Antibody
E-AB-53275-03 120 µL

TCF7 Polyclonal Antibody

Sign In for Pricing
View Details
TCF7 Polyclonal Antibody
E-AB-53275-04 200 µL

TCF7 Polyclonal Antibody

Sign In for Pricing
View Details
PerCP Anti-Human CD15/SSEA-1 Antibody[HI98]
E-AB-F1079F-01 20 Tests

PerCP Anti-Human CD15/SSEA-1 Antibody[HI98]

Sign In for Pricing
View Details