Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caulobacter crescentus NADH-quinone oxidoreductase subunit K (nuoK)

This Recombinant Caulobacter crescentus NADH-quinone oxidoreductase subunit K (nuoK) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit K, EC= 1.6.99.5, NADH dehydrogenase I subunit K, NDH-1 subunit K

UniProt

Q9A6Y6

Expression Region

1-101

Origin

Caulobacter crescentus (strain ATCC 19089 / CB15)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIGLPHYLVVAAILFTIGVFGIFVNRKNVIVILMSIELILLAVNINLVAFSAYLHDVAGQ IFAMFVLTVAAAEAAVGLAILVTFFRNRGDIAVDDASMMKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL
BNC140146-500 1x 500 µL

CD10 (CB-CALLA), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF568 conjugate, 0.1mg/mL
BNC681775-100 1x 100 µL

CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin-A (NAPSA/1239), CF740 conjugate, 0.1mg/mL
BNC741239-500 1x 500 µL

Napsin-A (NAPSA/1239), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF640R conjugate, 0.1mg/mL
BNC401908-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details