Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit 4L (ndhE)

This Recombinant Synechococcus sp. NAD (P) H-quinone oxidoreductase subunit 4L (ndhE) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 4L, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 4L, NADH-plastoquinone oxidoreductase subunit 4L, NDH-1, subunit 4L, NDH-E

UniProt

Q2JU34

Expression Region

1-102

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLQLQFFLVVAAILFCIGIYGLIVSRNAIRVLMSIELMLNAVNLNFMAFSNFVDSGLIRG QVFSVFVITVAAAEAAVGLAIVLGIYRNRATIDMESFNLLRW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HCG-beta (hCGb/459), CF405S conjugate, 0.1mg/mL
BNC040211-100 1x 100 µL

HCG-beta (hCGb/459), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (1415-1), CF405S conjugate, 0.1mg/mL
BNC040580-100 1x 100 µL

Histone H1 (1415-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF640R conjugate, 0.1mg/mL
BNC402298-100 1x 100 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), Biotin conjugate, 0.1mg/mL
BNCB0745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799 + KRT19/800), CF405S conjugate, 0.1mg/mL
BNC041150-500 1x 500 µL

Cytokeratin 19 (KRT19/799 + KRT19/800), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details