Recombinant Koribacter versatilis NADH-quinone oxidoreductase subunit K 2 (nuoK2)
This Recombinant Koribacter versatilis NADH-quinone oxidoreductase subunit K 2 (nuoK2) spans the amino acid sequence from region 1-103.
Product Specifications
Product Name Alternative
NADH-quinone oxidoreductase subunit K 2, EC= 1.6.99.5, NADH dehydrogenase I subunit K 2, NDH-1 subunit K 2
UniProt
Q1IS42
Expression Region
1-103
Origin
Koribacter versatilis (strain Ellin345)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSSTIPLAWYLMLSAFLFICGVIGFMIKRNIITIFMCIELMLNAVNLTFVAYATELRSLS GHIFVFFVMVVAAAESAVGLGIIIAVFRSRETLNVDRVNLLKL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470177-100 1x 100 µL
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470225-100 1x 100 µL
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details