Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter hepaticus ATP synthase subunit c (atpE)

This Recombinant Helicobacter hepaticus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7VIL1

Expression Region

1-103

Origin

Helicobacter hepaticus (strain ATCC 51449 / 3B1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFLALLCLGMVGFAFGAEVSGLDMIKSYSIAGAVIGLGIAALGGAIGMGHAAAATISGT ARNPGISGKLLGTMFIALALIEAQVIYTLVLALIALYANPFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLL4 Polyclonal Antibody
E-AB-70190-01 60 µL

DLL4 Polyclonal Antibody

Sign In for Pricing
View Details
DLL4 Polyclonal Antibody
E-AB-70190-02 120 µL

DLL4 Polyclonal Antibody

Sign In for Pricing
View Details
DLL4 Polyclonal Antibody
E-AB-70190-03 200 µL

DLL4 Polyclonal Antibody

Sign In for Pricing
View Details
CD62L (L-Selectin) (CD62L/1588), 0.2mg/mL
BNUB1588-500 1x 500 µL

CD62L (L-Selectin) (CD62L/1588), 0.2mg/mL

Sign In for Pricing
View Details
Human Creatine Kinase, Muscle (CKM) ELISA Kit
RDR-CKM-Hu-01 96 Tests

Human Creatine Kinase, Muscle (CKM) ELISA Kit

Sign In for Pricing
View Details
Human Creatine Kinase, Muscle (CKM) ELISA Kit
RDR-CKM-Hu-02 48 Tests

Human Creatine Kinase, Muscle (CKM) ELISA Kit

Sign In for Pricing
View Details