Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae Type IV secretion system protein virB3 (virB3)

This Recombinant Bartonella henselae Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

Q9S3N1

Expression Region

1-103

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDPLFLACTRPAMFAGVTMEAMAFNVMATSILFILTSGFTMIGLGIGLHFVLREITKH DHNQFRVLFAWLNTRGKQKNLNRWGGGSTSPLRLIRTYEELNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 1 Receptor Antagonist (IL1RA) ELISA Kit
RD-IL1RA-Mu-01 96 Tests

Mouse Interleukin 1 Receptor Antagonist (IL1RA) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1 Receptor Antagonist (IL1RA) ELISA Kit
RD-IL1RA-Mu-02 48 Tests

Mouse Interleukin 1 Receptor Antagonist (IL1RA) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS631464 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2961), 0.2mg/mL
BNUB2961-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2961), 0.2mg/mL

Sign In for Pricing
View Details
IRF1 Recombinant Rabbit Monoclonal Antibody [SR44-08]
ET1602-28 100 µL

IRF1 Recombinant Rabbit Monoclonal Antibody [SR44-08]

Sign In for Pricing
View Details
Galectin 3 Polyclonal Antibody
E-AB-40380-01 25 µL

Galectin 3 Polyclonal Antibody

Sign In for Pricing
View Details