Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella henselae Type IV secretion system protein virB3 (virB3)

This Recombinant Bartonella henselae Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

Q9S3N1

Expression Region

1-103

Origin

Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDPLFLACTRPAMFAGVTMEAMAFNVMATSILFILTSGFTMIGLGIGLHFVLREITKH DHNQFRVLFAWLNTRGKQKNLNRWGGGSTSPLRLIRTYEELNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Racking Shelf for C660/C760
FRE6156 1 Each

Racking Shelf for C660/C760

Sign In for Pricing
View Details
β-catenin (E-2) P
sc-515074 P 100 µg - 0.5 mL

β-catenin (E-2) P

Sign In for Pricing
View Details
MCA1 Antibody
orb847855 2 mg

MCA1 Antibody

Sign In for Pricing
View Details
CD7 Rabbit Polyclonal Antibody (PE)
orb2452188 100 µL

CD7 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
APY29
B3288-50 50 mg

APY29

Sign In for Pricing
View Details
IQCD Antibody
MBS854550-01 0.1 mg

IQCD Antibody

Sign In for Pricing
View Details