Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0761 (AF_0761)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0761 (AF_0761) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0761

UniProt

O29497

Expression Region

1-105

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENIMDEKGQMILLFAFVVVIVVLTLSYVYAQNIIAGVESSRAMLAFPKEEIRNLEEIQK NFGGDSEVNSQIQTLCAKNGWVCYVGVDKVEFKNVEVDYCAGSDC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdkn1c Mouse Gene Knockout Kit (CRISPR)
KN503060 1 Kit

Cdkn1c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS500879 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
SB 202190
TRC-S154495-50MG 50 mg

SB 202190

Sign In for Pricing
View Details
2-[(1,2,3,6,7,8-Hexahydro-4-pyrenyl)carbonyl]benzoic Acid
TRC-H294710-25MG 25 mg

2-[(1,2,3,6,7,8-Hexahydro-4-pyrenyl)carbonyl]benzoic Acid

Sign In for Pricing
View Details
Carboxypeptidase A (CPA1) (NM_001868) Human Over-expression Lysate
LY419696 100 µg

Carboxypeptidase A (CPA1) (NM_001868) Human Over-expression Lysate

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker), CF740 conjugate, 0.1mg/mL
BNC741657-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details